Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0103800_circ_g.2 |
| ID in PlantcircBase | osa_circ_012635 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 183986-184604 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ei-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0103850 |
| Parent gene annotation |
Hypothetical protein. (Os02t0103850-00) |
| Parent gene strand | + |
| Alternative splicing | Os02g0103800_circ_g.1 Os02g0103800_circ_g.3 Os02g0103800_circ_g.4 Os02g0103800_circ_g.5 Os02g0103800_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0103800-02:3 Os02t0103800-01:2 Os02t0103800-03:2 Os02t0103800-02:3 Os02t0103800-01:2 Os02t0103850-00:2 Os02t0103800-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003573* |
| PMCS | 0.664461104 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
184402-184452(-) |
| Potential amino acid sequence |
MLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEEHDDYKFNGLAWLFLGVPTSSTLLYREEFER MKETNAAGEKMYIQTRMAEYKDELWELLKKDNTYVYMCGLKGMEKGIDDIMIDLAAKDGIAVRE EAGVHQRSGRDRQRSLLQLPL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |