Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0103800_circ_g.2 |
ID in PlantcircBase | osa_circ_012635 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 183986-184604 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ei-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0103850 |
Parent gene annotation |
Hypothetical protein. (Os02t0103850-00) |
Parent gene strand | + |
Alternative splicing | Os02g0103800_circ_g.1 Os02g0103800_circ_g.3 Os02g0103800_circ_g.4 Os02g0103800_circ_g.5 Os02g0103800_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0103800-02:3 Os02t0103800-01:2 Os02t0103800-03:2 Os02t0103800-02:3 Os02t0103800-01:2 Os02t0103850-00:2 Os02t0103800-03:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003573* |
PMCS | 0.664461104 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
184402-184452(-) |
Potential amino acid sequence |
MLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEEHDDYKFNGLAWLFLGVPTSSTLLYREEFER MKETNAAGEKMYIQTRMAEYKDELWELLKKDNTYVYMCGLKGMEKGIDDIMIDLAAKDGIAVRE EAGVHQRSGRDRQRSLLQLPL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |