Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0133800_circ_g.5 |
| ID in PlantcircBase | osa_circ_029546 |
| Alias | Os_ciR4903 |
| Organism | Oryza sativa |
| Position | chr6: 1810723-1811005 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0133800 |
| Parent gene annotation |
Similar to Transferase. (Os06t0133800-01);Similar to Transketola se, chloroplastic. (Os06t0133800-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0133800_circ_g.4 Os06g0133800_circ_g.6 |
| Support reads | 4/2 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0133800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006500* osi_circ_016260 |
| PMCS | 1.021761274 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1810820-1810724(+) 1810864-1810786(+) 1810979-1810960(-) |
| Potential amino acid sequence |
MPPKSLKASTHILSECNLCVSVNGNVVVIIECNQLAKTPMASQRASFIGDTLHLAPISQNTVA* (+) MQSLCLRQWKCGCHHRMQSACQDPNGQPTSKLHWRYPPSGTHLPKYSSLISVGLSVTAFASLMA ARISS*(+) MEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSARFEALGWHTIWVKNGNDGY DEIRAAIKEAKAVTDKPTLIKLLYFGRWVPDGGYLQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |