Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0133800_circ_g.5 |
ID in PlantcircBase | osa_circ_029546 |
Alias | Os_ciR4903 |
Organism | Oryza sativa |
Position | chr6: 1810723-1811005 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os06g0133800 |
Parent gene annotation |
Similar to Transferase. (Os06t0133800-01);Similar to Transketola se, chloroplastic. (Os06t0133800-02) |
Parent gene strand | - |
Alternative splicing | Os06g0133800_circ_g.4 Os06g0133800_circ_g.6 |
Support reads | 4/2 |
Tissues | root/shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0133800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006500* osi_circ_016260 |
PMCS | 1.021761274 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1810820-1810724(+) 1810864-1810786(+) 1810979-1810960(-) |
Potential amino acid sequence |
MPPKSLKASTHILSECNLCVSVNGNVVVIIECNQLAKTPMASQRASFIGDTLHLAPISQNTVA* (+) MQSLCLRQWKCGCHHRMQSACQDPNGQPTSKLHWRYPPSGTHLPKYSSLISVGLSVTAFASLMA ARISS*(+) MEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSARFEALGWHTIWVKNGNDGY DEIRAAIKEAKAVTDKPTLIKLLYFGRWVPDGGYLQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |