Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0578700_circ_g.5 |
| ID in PlantcircBase | osa_circ_024983 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 29190742-29192681 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os04g0578700 |
| Parent gene annotation |
Similar to H0404F02.16 protein. (Os04t0578700-01);Similar to H04 04F02.16 protein. (Os04t0578700-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0578700-01:3 Os04t0578700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.116628862 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29191980-29192656(-) |
| Potential amino acid sequence |
MAGTFSISSILIGIFVTLDRHLARDLFTITWLENRELGTVTGSCSGFINSVEVSPISITLPSID PAYLELPKAP*(-) |
| Sponge-miRNAs | osa-miR529a |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |