Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0194800_circ_g.3 |
| ID in PlantcircBase | osa_circ_013621 |
| Alias | Os_ciR8309 |
| Organism | Oryza sativa |
| Position | chr2: 5302035-5302175 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0194800 |
| Parent gene annotation |
C-CAP/cofactor C-like domain domain containing protein. (Os02t01 94800-01);C-CAP/cofactor C-like domain domain containing protein . (Os02t0194800-02);Non-protein coding transcript. (Os02t0194800 -03) |
| Parent gene strand | - |
| Alternative splicing | Os02g0194800_circ_g.2 Os02g0194800_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0194800-01:1 Os02t0194800-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.306146217 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5302045-5302037(+) |
| Potential amino acid sequence |
MVVPHNKRLVIYSQVEYALTTVSNTNPFSSCNNMNSFTMLHLNNL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |