Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0659500_circ_g.1 |
| ID in PlantcircBase | osa_circ_025783 |
| Alias | Os_ciR2072 |
| Organism | Oryza sativa |
| Position | chr4: 33651056-33652514 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0659500 |
| Parent gene annotation |
Protein phosphatase 2C domain containing protein. (Os04t0659500- 01);Similar to OSIGBa0132E09-OSIGBa0108L24.16 protein. (Os04t065 9500-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0659500_circ_g.2 Os04g0659500_circ_g.3 |
| Support reads | 9/4 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0659500-02:5 Os04t0659500-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.17686188 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33651960-33651310(+) 33651238-33651998(-) |
| Potential amino acid sequence |
MTEEILFNILSYFSTTMTILAESQDPQLHTALRVCHQKREKQQAHHQHAMFLPTLQNLQHLRYV VAHLSDQACDLLKQL*(+) MWAGTWRVGGVLAVSRAFGDKLLKQYVVVDPEIRPEWSWWC*(-) |
| Sponge-miRNAs | osa-miR1435 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |