Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G23230_circ_g.3 |
ID in PlantcircBase | ath_circ_004013 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 8249047-8249172 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, CIRI-full |
Parent gene | AT1G23230 |
Parent gene annotation |
Mediator of RNA polymerase II transcription subunit 23 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G23230.2:1 AT1G23230.3:1 AT1G23230.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.265925068 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8249101-8249169(+) |
Potential amino acid sequence |
MLPLDIFLLALIDRDDDPHALIIAAVLDKAGANLAFFFWTHEMLPLDIFLLALIDRDDDPHALI IAAVLDKAGANLAFFFWTHEMLPLDIFLLALIDRDDDPHALIIAAVLDKAGANLAFFFWTHEML PLDIFLLALIDRDDDPHALIIA(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |