Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0199200_circ_g.2 |
| ID in PlantcircBase | osa_circ_008765 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 4971684-4972126 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0199200 |
| Parent gene annotation |
Protein disulfide isomerase-like enzyme, Starch synthesis, Matur ation of proglutelin in endosperm (Os11t0199200-01);Similar to P rotein disulfide isomerase. (Os11t0199200-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0199200_circ_g.3 Os11g0199200_circ_g.4 Os11g0199200_circ_g.5 Os11g0199200_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0199200-02:2 Os11t0199200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.183408634 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4972113-4971691(-) |
| Potential amino acid sequence |
MHHGADTARSWLQSWMRQLRRLKATRMLSSLRWMQLRTMCQASSMCKVTPPCTSSPPVERWFPM KAAGQPTRSSTSLRRTRKPLVRRRRRQSRPQPSLSRMSSKQVLVEFYAPWCGHCKKLAPILDEA ATTLKSDKDVVIAKMDATANDVPSEFDVQGYPTLYFVTPSGKMVPYESGRTADEIVDFIKKNKE TAGQAKEKAESAPAEPLKDEL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |