Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G12370_circ_g.9 |
| ID in PlantcircBase | ath_circ_037804 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 4005786-4006044 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT5G12370 |
| Parent gene annotation |
Exocyst complex component SEC10a |
| Parent gene strand | - |
| Alternative splicing | 5_circ_ag.5 AT5G12370_circ_g.1 AT5G12370_circ_g.2 AT5G12370_circ_g.3 AT5G12370_circ_g.4 AT5G12370_circ_g.5 AT5G12370_circ_g.6 AT5G12370_circ_g.7 AT5G12370_circ_g.8 AT5G12370_circ_g.10 AT5G12370_circ_g.11 AT5G12370_circ_g.12 AT5G12370_circ_g.13 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G12370.2:2 AT5G12370.1:2 AT5G12370.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223669723 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4006036-4005788(-) |
| Potential amino acid sequence |
MLAVAYERTQELAKDLRAVGCGDLDVEDLTESLFSSHKDEYPEHERASLKQLYQAKYLRMLAVA YERTQELAKDLRAVGCGDLDVEDLTESLFSSHKDEYPEHERASLKQLYQAKYLRMLAVAYERTQ ELAKDLRAVGCGDLDVEDLTESLFSSHKDEYPEHERASLKQLYQAKYLRMLAVAYERTQELAKD LRAVGCGDLDVEDLTESLFSSHKDEYPEHERASLKQLYQAK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |