Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0616300_circ_g.2 |
| ID in PlantcircBase | osa_circ_020648 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 23336523-23337329 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0616300 |
| Parent gene annotation |
Similar to DNA polymerase kappa (EC 2.7.7.7) (DINB protein) (DIN P). Splice isoform 4. (Os03t0616300-01);Similar to F2J10.13 prot ein. (Os03t0616300-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0616300-02:3 Os03t0616300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.134809789 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23336846-23336561(+) 23336797-23337321(-) 23336575-23337317(-) |
| Potential amino acid sequence |
MIAKVCSDINKPNGQFILPNDQEAVTTFVSTLPIRKFSKGTIPTLLQQA*(+) MAPLSSVATSSPVMPLSKQTFVILRYASSRLVATKLGSYLWKTFL*(-) MLHLGLLQQSWDRTFGKLSYR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |