Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0116100_circ_g.1 |
| ID in PlantcircBase | osa_circ_029439 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 886973-888106 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os06g0116100 |
| Parent gene annotation |
Hypothetical protein. (Os06t0116100-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0116100_circ_ag.1 Os06g0116100_circ_g.2 Os06g0116100_circ_g.3 Os06g0116100_circ_g.4 Os06g0116100_circ_g.5 Os06g0116300_circ_g.1 Os06g0116500_circ_g.1 Os06g0116500_circ_g.2 |
| Support reads | 74 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0116100-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.186859708 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
887899-887197(+) 887014-888086(-) |
| Potential amino acid sequence |
MERYKIIKEVGDGTFGSVWRAINKESGEVVPTPCTARALAFSLRIWSTPSTPQVPLYCTFRCSR KFLAGGFLFTETSSLSLLSTAPEDHTSFSSRLAWSHAIAH*(+) MRMLEPWQCTVLEPLHHSLC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |