Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_01G111300_circ_g.1 |
| ID in PlantcircBase | gma_circ_007888 |
| Alias | circRNA2094 |
| Organism | Glycine max |
| Position | chr1: 37737883-37738508 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | CIRI, CIRCexplorer |
| Parent gene | GLYMA_01G111300 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | pod |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH75813:1 KRH75812:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.008421193 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37737886-37737885(+) 37737904-37738408(-) |
| Potential amino acid sequence |
MNGSRHEARSSAAISTENHLDSKKLPNPEPEKKINGSQADESIKVPNPEPEKKINGSQVDESIK VPNPEPEKKINGSQVDESIKVPTIVDNSSVNAGSLETVHADNKTSTGRRLLEDNNSKGAEQGGS ESKDKEGIHAATVENDEGLEADADSSFELFRNSEDLADEYSYDYDDYVDESMWGDEEWTEVKHE KLEDFVNVDSHILCTPK*(+) MSTSIHLGVHKMWESTFTKSSNFSCLTSVHSSSPHIDSST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021a |