Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G45850_circ_g.11 |
| ID in PlantcircBase | ath_circ_026206 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 16858690-16858902 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G45850 |
| Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT3G45850_circ_g.6 AT3G45850_circ_g.7 AT3G45850_circ_g.8 AT3G45850_circ_g.9 AT3G45850_circ_g.10 AT3G45850_circ_g.12 AT3G45850_circ_g.13 AT3G45850_circ_g.14 |
| Support reads | 2 |
| Tissues | aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G45850.1:2 AT3G45850.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.215976017 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16858900-16858692(-) |
| Potential amino acid sequence |
MAEKIERLELQSESKDKRVVDLQELYNSQQILTAELSEKLEKTEAMAEKIERLELQSESKDKRV VDLQELYNSQQILTAELSEKLEKTEAMAEKIERLELQSESKDKRVVDLQELYNSQQILTAELSE KLEKTEAMAEKIERLELQSESKDKRVVDLQELYNSQQILTAELSEKLEKTE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |