Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d000240_circ_g.1 |
ID in PlantcircBase | zma_circ_010395 |
Alias | Zm_ctg_circ00001 |
Organism | Zea mays |
Position | chrB73V4_ctg11: 23138-25887 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d000240 |
Parent gene annotation |
Transcription initiation factor IIF beta subunit |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d000240_T009:3 Zm00001d000240_T003:3 Zm00001d000240_T001:1 Zm00001d000240_T006:2 Zm00001d000240_T010:3 Zm00001d000240_T008:2 Zm00001d000240_T005:3 Zm00001d000240_T002:2 Zm00001d000240_T007:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.101184285 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25835-23365(+) |
Potential amino acid sequence |
MSMRPMPGLVGLIPSGSKFKMELAQTNTGNTPKSYSLNMFKDFVPMCVFSESNQGRIQIHSFFL SALYCLSARLKSSLLPRAPARRDLSLFLRG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |