Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G109300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000608 |
| Alias | Chr06:35339304|35339731 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 35339304-35339731 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G109300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 5/3 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G109300.1:2 Gorai.006G109300.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000135* gar_circ_000197 |
| PMCS | 0.463434268 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35339630-35339724(-) 35339352-35339674(-) |
| Potential amino acid sequence |
MRTMMMIVIPRMEVVLMMKMIPRMKTKRCLWMKVQMRMRRHLRRKS*(-) MSVDESSDEDEETPKKEKLRQMQKQPKLMLGNLML*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |