Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d008954_circ_g.1 |
ID in PlantcircBase | zma_circ_009575 |
Alias | Zm08circ00015, zma_circ_0002680, GRMZM2G154221_C1 |
Organism | Zea mays |
Position | chr8: 26895941-26902038 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d008954 |
Parent gene annotation |
Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d008954_T003:6 Zm00001d008954_T005:5 Zm00001d008954_T007:6 Zm00001d008954_T002:7 Zm00001d008954_T006:6 Zm00001d008954_T008:4 Zm00001d008954_T001:6 Zm00001d008954_T004:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.142445289 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26901986-26902009(-) |
Potential amino acid sequence |
MKDSQDIQSTTELQSSAQGTNEVQSQQPNPMTTDAPAGNSGSLSIASNDSKKVSREDIELVQNL IERCLQLYMNKGEVVRTLSTRARIEPGFTTLVWQKLEEENSEFFRAYYIRLKLKRQIILFNHLL QHQYNLMKYPAPPNVPLAPIQNGIHHMPVSNLPMGYPVLPQPIMPAPGQPHMDPMACGLSNGHV VNGIPAPGGYHPMRMNSGNDMVVDNGAPEAPHAGATGSVMSSEMAVSPSSAASSNHAPFMPPEI PGMAMDVPGLDSTFGSDVGNGPLQLGPDGSSRDSIRSLGQLWNFSLSDLTADLTSLGGKVLLLA SYS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |