Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0205900_circ_g.2 |
| ID in PlantcircBase | osa_circ_036348 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 6172802-6172890 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os08g0205900 |
| Parent gene annotation |
Similar to Viroid RNA-binding protein (Fragment). (Os08t0205900- 01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0205900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.324900655 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6172810-6172821(+) |
| Potential amino acid sequence |
MEAPVVRAICVQNKRSWQIKLLVKSRKTGRWKRQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |