Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc04g082880.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_001597 |
| Alias | 4:63979872|63980251 |
| Organism | Solanum lycopersicum |
| Position | chr4: 66386502-66386881 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc04g082880.2 |
| Parent gene annotation |
Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 11 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc04g082880.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.194521754 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
66386874-66386646(+) 66386518-66386504(-) |
| Potential amino acid sequence |
MNFQSLVHFCFHEMSYKFLGLNL*(+) MNKRLEIHGLLRQGVSADNISSQLSPWASALFEFLPHFIRKQLLLHPESDDSAQLSQIETEKLI AHLVETEMNKRLEIHGLLRQGVSADNISSQLSPWASALFEFLPHFIRKQLLLHPESDDSAQLSQ IETEKLIAHLVETEMNKRLEIHGLLRQGVSADNISSQLSPWASALFEFLPHFIRKQLLLHPESD DSAQLSQIETEKLIAHLVETEMNKRL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |