Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d029231_circ_g.2 |
ID in PlantcircBase | zma_circ_006534 |
Alias | zma_circ_0000686 |
Organism | Zea mays |
Position | chr1: 63231919-63233638 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d029231 |
Parent gene annotation |
Aminotransferase, class IV family protein |
Parent gene strand | - |
Alternative splicing | Zm00001d029231_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d029231_T001:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.07627608 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
63233629-63232668(+) |
Potential amino acid sequence |
MSSLRGYWRGLEKPEDLCTLPYHQGAHIPSNSLGPASHLKRGNNSNSTFVAGKECPDPHRDHLG RPQDPVADHLHLSQGVGSQVHIIHCILRQVRLCQAP*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |