Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0651100_circ_g.1 |
| ID in PlantcircBase | osa_circ_031799 |
| Alias | Os_ciR10531 |
| Organism | Oryza sativa |
| Position | chr6: 26656413-26657456 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0651100 |
| Parent gene annotation |
Similar to NADPH HC toxin reductase. (Os06t0651100-01);Similar t o NADPH HC toxin reductase. (Os06t0651100-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/5 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0651100-02:2 Os06t0651100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.253944109 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26657372-26656416(+) 26657359-26657416(-) |
| Potential amino acid sequence |
MTRFTVLDSSHCRRITRAASSAASAVLLYL*(+) MAATSPLKEDSTGFKDSIDESCWTPLAVDYPYRSARFDEYILSKLLSEKELLGHSHAGERRRPA VEVVTVPCSVVAGGTLQGQSTTSLDCVVSPVSRDEGRFRALRLLQRLMGSVPMVHVDDVCDALV FCMEQPSLTGRFLCSAAYPTLDDIVEHFAGKYPHLDLLKDTITRRRRRWTRHG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |