Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d052735_circ_g.1 |
ID in PlantcircBase | zma_circ_008213 |
Alias | zma_circ_0001650 |
Organism | Zea mays |
Position | chr4: 199341419-199342165 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d052735 |
Parent gene annotation |
Plant UBX domain-containing protein 8 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d052735_T011:3 Zm00001d052735_T005:3 Zm00001d052735_T006:3 Zm00001d052735_T004:3 Zm00001d052735_T014:3 Zm00001d052735_T003:3 Zm00001d052735_T008:3 Zm00001d052735_T010:3 Zm00001d052735_T002:3 Zm00001d052735_T013:3 Zm00001d052735_T009:3 Zm00001d052735_T012:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.185080285 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
199341781-199341451(+) |
Potential amino acid sequence |
MLEAAMFGGIPEGAPYPFSFPAHGRSTHYPLVARPPSPSLTAQRLLREQQDDEYLAALQADREK ELKAVQEAELRRVEEAAAREAALERQKKEEEEKLKKQREEEARTNYRRSGNF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |