Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G64880_circ_g.1 |
ID in PlantcircBase | ath_circ_008730 |
Alias | At_ciR2008, Ath_circ_FC0880 |
Organism | Arabidpsis thaliana |
Position | chr1: 24108211-24108492 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT1G64880 |
Parent gene annotation |
At1g64880 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 4 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G64880.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.185485166 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24108427-24108489(+) |
Potential amino acid sequence |
MKAGRVVKTILLLAGFKNIKSKAYEKCFQNLHYVERHEEHTIAHAIQTSYKKTKLYLWPAPTTT GMKAGRVVKTILLLAGFKNIKSKAYEKCFQNLHYVERHEEHTIAHAIQTSYKKTKLYLWPAPTT TGMKAGRVVKTILLLAGFKNIKSKAYEKCFQNLHYVERHEEHTIAHAIQTSYKKTKLYLWPAPT TTGMKAGRVVKTILLLAGFKNIKSK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chen et al., 2017a |