Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0304000_circ_g.2 |
| ID in PlantcircBase | osa_circ_001486 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 11250941-11251054 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0304000 |
| Parent gene annotation |
Similar to Ribosomal protein L29. (Os01t0304000-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | anther |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0304000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.43641652 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11251044-11250943(-) |
| Potential amino acid sequence |
MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKGDSGEMAKSKNHTAHNQSYKAHKNGIKKPKR HRQTSTKGDSGEMAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKGDSGEMAKSKNHTAHNQSY KAHKNGIKKPKRHRQTSTKG(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |