Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d046039_circ_g.10 |
ID in PlantcircBase | zma_circ_009944 |
Alias | zma_circ_0003225 |
Organism | Zea mays |
Position | chr9: 58165199-58166218 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d046039 |
Parent gene annotation |
HEAT repeat-containing protein |
Parent gene strand | - |
Alternative splicing | Zm00001d046039_circ_g.8 Zm00001d046039_circ_g.9 Zm00001d046039_circ_g.11 Zm00001d046039_circ_g.12 Zm00001d046039_circ_g.13 Zm00001d046039_circ_g.14 Zm00001d046039_circ_g.15 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d046039_T010:3 Zm00001d046039_T004:3 Zm00001d046039_T003:3 Zm00001d046039_T021:3 Zm00001d046039_T040:3 Zm00001d046039_T001:3 Zm00001d046039_T033:3 Zm00001d046039_T024:3 Zm00001d046039_T035:3 Zm00001d046039_T027:3 Zm00001d046039_T006:3 Zm00001d046039_T039:3 Zm00001d046039_T017:3 Zm00001d046039_T029:3 Zm00001d046039_T052:3 Zm00001d046039_T015:3 Zm00001d046039_T014:3 Zm00001d046039_T037:3 Zm00001d046039_T007:3 Zm00001d046039_T031:3 Zm00001d046039_T030:3 Zm00001d046039_T011:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.128895253 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
58165283-58165524(-) 58165218-58165524(-) |
Potential amino acid sequence |
MAYWSLSNPVVYKTEHQQILQLCSSPFRSWKTRCLMFFCYGRVLLLEILNLTFVIYRIGHQNCG FCQLQLRRLLPS*(-) MLKSVQELEDQVFDVLLLWAGPFTGNPESYLRHIQDWASELRVLSVAVEALTAFIRSFVYPSIT TTDCGILLNPVLAYLGGALSLISSLRSKQVPNVRSALDLLTTRTLMAYWSLSNPVVYKTEHQQI LQLCSSPFRSWKTRCLMFFCYGRVLLLEILNLTFVIYRIGHQNCGFCQLQLRRLLPS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |