Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G06810_circ_g.1 |
ID in PlantcircBase | ath_circ_020163 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 2147357-2147488 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G06810 |
Parent gene annotation |
Probable acyl-CoA dehydrogenase IBR3 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 4 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G06810.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.133838392 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2147415-2147359(-) |
Potential amino acid sequence |
MPRLWRLHDRSHFSFQVLHSVFCSNCLADHISQDQWHPHQQSEEMPRLWRLHDRSHFSFQVLHS VFCSNCLADHISQDQWHPHQQSEEMPRLWRLHDRSHFSFQVLHSVFCSNCLADHISQDQWHPHQ QSEEMPRLWRLHDRSHFSFQVLH(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |