Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G06810_circ_g.1 |
| ID in PlantcircBase | ath_circ_020163 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 2147357-2147488 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G06810 |
| Parent gene annotation |
Probable acyl-CoA dehydrogenase IBR3 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G06810.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133838392 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2147415-2147359(-) |
| Potential amino acid sequence |
MPRLWRLHDRSHFSFQVLHSVFCSNCLADHISQDQWHPHQQSEEMPRLWRLHDRSHFSFQVLHS VFCSNCLADHISQDQWHPHQQSEEMPRLWRLHDRSHFSFQVLHSVFCSNCLADHISQDQWHPHQ QSEEMPRLWRLHDRSHFSFQVLH(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |