Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d018423_circ_g.3 |
ID in PlantcircBase | zma_circ_008839 |
Alias | zma_circ_0002018 |
Organism | Zea mays |
Position | chr5: 220516022-220516519 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d018423 |
Parent gene annotation |
UDP-glucose:glycoprotein glucosyltransferase |
Parent gene strand | - |
Alternative splicing | Zm00001d018423_circ_g.2 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d018423_T005:2 Zm00001d018423_T004:2 Zm00001d018423_T011:2 Zm00001d018423_T009:2 Zm00001d018423_T007:2 Zm00001d018423_T013:2 Zm00001d018423_T017:2 Zm00001d018423_T026:2 Zm00001d018423_T024:2 Zm00001d018423_T002:2 Zm00001d018423_T010:2 Zm00001d018423_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.231751266 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
220516389-220516024(-) |
Potential amino acid sequence |
MEYKAMDDTAIKKGVPLEDPKTEDLSQEVRGFIFSKILGKIRYALRPVLPSGCETTSTFCGSVG AVDAVTLSGYGVELALKNMEYKAMDDTAIKKGVPLEDPKTEDLSQEVRGFIFSKILGKIRYALR PVLPSGCETTSTFCGSVGAVDAVTLSGYGVELALKNMEYKAMDDTAIKKGVPLEDPKTEDLSQE VRGFIFSKILGKIRYALRPVLPSGCETTSTFCGSVGAVDAVTLSGYGVELALKNMEYKAMDDTA IKKGVPLEDPKTEDLSQEVRGFIFSKIL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |