Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0815850_circ_g.1 |
ID in PlantcircBase | osa_circ_004575 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 34684448-34684596 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder |
Parent gene | Os01g0815800 |
Parent gene annotation |
Similar to 60S ribosomal protein L24-A (L30A) (RP29) (YL21). (Os 01t0815800-01);Non-protein coding transcript. (Os01t0815800-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 75 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0815850-00:1 Os01t0815850-00:1 Os01t0815800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.533251983 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34684456-34684458(+) 34684454-34684535(-) 34684458-34684455(-) |
Potential amino acid sequence |
MLKLSRRGVAPPRSHTHGQLLVLHWKLSKRRGVRNLKSVMQPEKRLSGHSC*(+) MSGEPLLWLHHGLQVSHSSSFG*(-) MNVRRAASLAASRTSGFSLLFFWITSSVAPTIDREYGFLVVRRLFLTASA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |