Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0815850_circ_g.1 |
| ID in PlantcircBase | osa_circ_004575 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 34684448-34684596 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder |
| Parent gene | Os01g0815800 |
| Parent gene annotation |
Similar to 60S ribosomal protein L24-A (L30A) (RP29) (YL21). (Os 01t0815800-01);Non-protein coding transcript. (Os01t0815800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 75 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0815850-00:1 Os01t0815850-00:1 Os01t0815800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.533251983 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34684456-34684458(+) 34684454-34684535(-) 34684458-34684455(-) |
| Potential amino acid sequence |
MLKLSRRGVAPPRSHTHGQLLVLHWKLSKRRGVRNLKSVMQPEKRLSGHSC*(+) MSGEPLLWLHHGLQVSHSSSFG*(-) MNVRRAASLAASRTSGFSLLFFWITSSVAPTIDREYGFLVVRRLFLTASA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |