Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0224900_circ_g.1 |
ID in PlantcircBase | osa_circ_023120 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 8307710-8308007 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0224900 |
Parent gene annotation |
FAD-dependent glycerol-3-phosphate dehydrogenase domain containi ng protein. (Os04t0224900-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0224900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_019064 |
PMCS | 0.460843848 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8307948-8307978(+) 8307741-8308005(-) |
Potential amino acid sequence |
MLLQPPKMGIHEQVASPSLHSLCLPSLNCAFLDDLNVSRKSLPFCSSSFCLALSHLRSRAKISM IRGNALPAASVSRNARRHLLAMKSTADSQYSWRAQYATSASKNGYP*(+) MHNSGMANIMNEGLGKRLAHGYPFLEAEVAYCARHEYCESAVDFIARRCRLAFLDTDAAGRALP RIIEILALERKWDKARQKLELQKGKDFLETFKSSKNAQFRDGKHNE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |