Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0010s02090_circ_g.1 |
| ID in PlantcircBase | pop_circ_002655 |
| Alias | Chr10:2628372|2629135 |
| Organism | Populus trichocarpa |
| Position | chr10: 2418357-2419120 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | POPTR_0010s02090 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem cambium |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | POPTR_0010s02090.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.164332755 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2419058-2418484(+) 2419060-2419113(-) |
| Potential amino acid sequence |
MVYFGEGGESVEAADLSSSSCFVNFYLSKELLLPLTYPLLSFFLHFLLIPFKLFDPPAMLMFLI *(+) MLEKWIMDQQRKKLLTEQGWVLKQQKTKQRIATCFDKLKETVSSSEDISAKTKIVIELKKLQLL ELQRRLRSNFLNDFFKPITNDMDRLKSYKKHKHGRRIKQLERYEQKMKEERQKRIRERQKEFFA EIEVHKTR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zheng et al., 2020 |