Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0112300_circ_g.1 |
| ID in PlantcircBase | osa_circ_022906 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 716856-717152 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0112300 |
| Parent gene annotation |
Eukaryotic initiation factor 3, gamma subunit family protein. (O s04t0112300-01);Eukaryotic initiation factor 3, gamma subunit fa mily protein. (Os04t0112300-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0112300-02:2 Os04t0112300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.287689675 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
716940-717151(-) 717077-717122(-) |
| Potential amino acid sequence |
MMLKVLLLICFPSCLIQLHLLSITNTFR*(-) MKYWSEHGFSSLIVAAPGHDVESFVADLLPLLSYSAPFAIYHQYLQIVKEMRMEVQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |