Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G079300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000593 |
| Alias | Chr06:30481800|30483888 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 30481800-30483888 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G079300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G079300.3:7 Gorai.006G079300.1:7 Gorai.006G079300.2:7 Gorai.006G079300.4:7 Gorai.006G079300.5:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.124515542 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30482716-30483882(-) 30481850-30483882(-) |
| Potential amino acid sequence |
MIIWSLDNRFVLAAIMDCRICVWNAADGSLVHSLSGHTDSVI*(-) MLLMAAWYILCLVILILSSDDGTCRIWDARNAEIRPRIYVPKPSDSLAGKNSSSSSTSVQQSHQ IFCCAFNANGTVFVTGSSDTLARVWVACKPNTDDSDQPNHEIDVLSGHENDVNYVQFSGCSVSS RYSTADSLKEESVPKFRNSWFSQDNIVTCSRDGSAIIWVPKSRRSHGKVGRWCKHYHLKVPPPP LPPQPPRGGPRQRILPTPRGVNMIIWSLDNRFVLAAIMDCRICVWNAADGSLVHSLSGHTDSVI *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |