Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0109600_circ_g.4 |
| ID in PlantcircBase | osa_circ_006116 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 678325-678507 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0109600 |
| Parent gene annotation |
Peroxidase (EC 1.11.1.7). (Os10t0109600-01);Peroxidase (EC 1.11. 1.7). (Os10t0109600-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0109600-02:1 Os10t0109600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.261889435 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
678360-678337(+) 678340-678410(-) |
| Potential amino acid sequence |
MSAQETTSGQMFSRSSFIASMTSNPLTEFLLGSANFSPSSPSRRMEPSHPNSTP*(+) MEYYLGVTVPSFWTVTTARNLHFPTRTLSEGSKSLTR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |