Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0499300_circ_g.7 |
| ID in PlantcircBase | osa_circ_024441 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 24950253-24951244 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0499500 |
| Parent gene annotation |
Hypothetical protein. (Os04t0499500-00) |
| Parent gene strand | + |
| Alternative splicing | Os04g0499300_circ_g.1 Os04g0499300_circ_g.2 Os04g0499300_circ_g.3 Os04g0499300_circ_g.4 Os04g0499300_circ_g.5 Os04g0499300_circ_g.6 |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0499300-01:2 Os04t0499300-01:2 Os04t0499500-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.20925746 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24950292-24950323(-) |
| Potential amino acid sequence |
MVKIRFGVALSQILVIQILRCASVFAIQEINFSNCVRSLTYLRPS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |