Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G21330_circ_g.4 |
| ID in PlantcircBase | ath_circ_014182 |
| Alias | Ath_circ_FC1119, Ath_circ_FC5605, AT2G21330_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 9128777-9129046 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, CIRI2 |
| Parent gene | AT2G21330 |
| Parent gene annotation |
Fructose-bisphosphate aldolase 1, chloroplastic |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 100 |
| Tissues | whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-GC |
| Number of exons covered | AT2G21330.1:1 AT2G21330.3:1 AT2G21330.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.665914083 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9129011-9128779(-) |
| Potential amino acid sequence |
MLDGEHGIDRTYDVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAEATDRATPEQVASYTLK LLRNRIPPAVPGIMDSGLVPIVEPEIMLDGEHGIDRTYDVAEKVWAEVFFYLAQNNVMFEGILL KPSMVTPGAEATDRATPEQVASYTLKLLRNRIPPAVPGIMDSGLVPIVEPEIMLDGEHGIDRTY DVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAEATDRATPEQVASYTLKLLRNRIPPAVPG IMDSGLVPIVEPEIMLDGEHGIDRTYDVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAEAT DRATPEQVASYTLKLLRNRIPPAVPGIM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |