Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d047750_circ_g.2 |
ID in PlantcircBase | zma_circ_010058 |
Alias | Zm09circ00065, GRMZM2G118959_C1 |
Organism | Zea mays |
Position | chr9: 140835362-140835629 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d047750 |
Parent gene annotation |
Probable beta-14-xylosyltransferase IRX9 |
Parent gene strand | - |
Alternative splicing | Zm00001d047750_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d047750_T002:1 Zm00001d047750_T001:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_019256 |
PMCS | 0.321967723 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
140835603-140835519(-) |
Potential amino acid sequence |
MWRDEREVVVRGPACSSSAVTGWFSQDLSDGTAAAASTTSTARARPSGEVDVHGFAFNSSVLWD PERWGRYPTSEPDKSQRVRCVAGGDDVAGREGGRRAGPRVQLVRGHRLVLPGPERRHRGCCLYH LHREGEAFWRGGRPRLRLQQLRALGPRALGPLPDLRARQVPARSVRGRWRRCGGTRGRSSCGAP RAARPRSPAGSPRT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |