Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0566500_circ_g.1 |
| ID in PlantcircBase | osa_circ_024912 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 28428143-28428510 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0566500 |
| Parent gene annotation |
Similar to Isoform 2 of Protein argonaute 1B. (Os04t0566500-01); Similar to Isoform 2 of Protein argonaute 1B. (Os04t0566500-02); Similar to Argonaute protein. (Os04t0566500-03);Similar to Argon aute protein. (Os04t0566500-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0566500-04:2 Os04t0566500-03:2 Os04t0566500-02:2 Os04t0566500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014670 |
| PMCS | 0.562585643 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28428435-28428143(+) 28428173-28428214(+) |
| Potential amino acid sequence |
MIVGLSLTRGILLVKASTSTVFLPPT*(+) MRVLPYFEKILYQFLTMGLGTHQSSILSDFRPVLRSNHSCNGRTGIFSRMRMSNIRTKYDSWSV TDKGNPPCQSIHKYSIPSPHLIMPPVTVPLCGSCHTLKRSCINS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |