Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0566500_circ_g.1 |
ID in PlantcircBase | osa_circ_024912 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 28428143-28428510 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0566500 |
Parent gene annotation |
Similar to Isoform 2 of Protein argonaute 1B. (Os04t0566500-01); Similar to Isoform 2 of Protein argonaute 1B. (Os04t0566500-02); Similar to Argonaute protein. (Os04t0566500-03);Similar to Argon aute protein. (Os04t0566500-04) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0566500-04:2 Os04t0566500-03:2 Os04t0566500-02:2 Os04t0566500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014670 |
PMCS | 0.562585643 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28428435-28428143(+) 28428173-28428214(+) |
Potential amino acid sequence |
MIVGLSLTRGILLVKASTSTVFLPPT*(+) MRVLPYFEKILYQFLTMGLGTHQSSILSDFRPVLRSNHSCNGRTGIFSRMRMSNIRTKYDSWSV TDKGNPPCQSIHKYSIPSPHLIMPPVTVPLCGSCHTLKRSCINS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |