Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0386900_circ_g.2 |
| ID in PlantcircBase | osa_circ_027730 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 18732700-18733272 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0386900 |
| Parent gene annotation |
Reticulon family protein. (Os05t0386900-01);Reticulon family pro tein. (Os05t0386900-02);Hypothetical conserved gene. (Os05t03869 00-03) |
| Parent gene strand | + |
| Alternative splicing | Os05g0386900_circ_g.1 Os05g0386900_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0386900-01:2 Os05t0386900-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.120564412 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18732836-18732751(+) 18732781-18732810(+) 18732838-18733259(-) |
| Potential amino acid sequence |
MPSTSSSKNSVRNVGNCSTGYRKKRNFRSSTRWRSGREQDWQGREGCET*(+) MEKNYDSIKDVTSFEDFYHAFYELIEKFCEERGQLQYRIPEKAELQKQYEVAIRQRTRLARTRR LRNLRMPRISPTSWKKTTTRSRT*(+) MVEIFEACHVLDRVVVFFHEVGEILGILRFRNLLVLASLVLCLIATSYCF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |