Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0190200_circ_g.1 |
| ID in PlantcircBase | osa_circ_036212 |
| Alias | Os_ciR11685 |
| Organism | Oryza sativa |
| Position | chr8: 5269394-5269524 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0190200 |
| Parent gene annotation |
Similar to cDNA clone:J033051E20, full insert sequence. (Os08t01 90200-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0190200-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.449384097 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5269445-5269405(+) 5269487-5269481(-) 5269462-5269507(-) |
| Potential amino acid sequence |
MDHISIGSENLFQHIVSDTGIKATNKYLLAN*(+) MLKQVFTPYGDVVHVKIPVGKRCGFVQFANRYLLVALIPVSLTIC*(-) MEMWSMLRSQLEKDVVLFNLLTDICWWP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |