Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0463300_circ_g.1 |
| ID in PlantcircBase | osa_circ_039480 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 17536059-17536994 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0463300 |
| Parent gene annotation |
Domain of unknown function DUF547 domain containing protein. (Os 09t0463300-01);Hypothetical conserved gene. (Os09t0463300-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0463232_circ_g.1 Os09g0463300_circ_g.2 Os09g0463300_circ_g.3 Os09g0463300_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0463300-02:3 Os09t0463300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.130854959 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17536151-17536085(+) 17536994-17536085(+) 17536125-17536981(-) |
| Potential amino acid sequence |
MMNAFLEQGIPTTPHMLVAMMPKATINVGGRTHSAMSIEHFILRLPYSVKHGFDPEAFIG*(+) MALIRRLSSVDLTGLSHQQKLAFWINIYNSCMMNAFLEQGIPTTPHMLVAMMPKATINVGGRTH SAMSIEHFILRLPYSVKHGFDPEAFIG*(+) MPASADGRAPSGQPMKASGSKPCFTL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |