Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G53730_circ_g.10 |
ID in PlantcircBase | ath_circ_007208 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 20063084-20063441 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G53730 |
Parent gene annotation |
STRUBBELIG-receptor family 6 |
Parent gene strand | + |
Alternative splicing | AT1G53730_circ_g.1 AT1G53730_circ_g.2 AT1G53730_circ_g.3 AT1G53730_circ_g.4 AT1G53730_circ_g.5 AT1G53730_circ_g.6 AT1G53730_circ_g.7 AT1G53730_circ_g.8 AT1G53730_circ_g.9 AT1G53730_circ_g.11 AT1G53730_circ_g.12 AT1G53730_circ_g.13 AT1G53730_circ_g.14 AT1G53730_circ_g.15 AT1G53730_circ_g.16 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G53730.2:3 AT1G53730.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.174135475 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20063440-20063438(+) |
Potential amino acid sequence |
MDFSFNSFTNSLPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKG ITLMDFSFNSFTNSLPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSS LKGITLMDFSFNSFTNSLPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWI PSSLKGITL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |