Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA029442_circ_g.6 |
ID in PlantcircBase | osi_circ_008168 |
Alias | 9:18865316|18865709 |
Organism | Oryza sativa ssp. indica |
Position | chr9: 18865316-18865709 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA029442 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA029442_circ_g.1 BGIOSGA029442_circ_g.2 BGIOSGA029442_circ_g.3 BGIOSGA029442_circ_g.4 BGIOSGA029442_circ_g.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA029442-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_039844* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18865710-18865671(-) |
Potential amino acid sequence |
MLKGRSFPGKVLLTRRSEPLSPPEYSPRYENDRDEYEQNEGSQEGKGQASGNTADSMSAKKSNP PSTSSTNSLPDAQGLVSGARATDSARIAKFTNELSRPAVILECSKGGAFLGRSC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |