Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0648200_circ_g.1 |
ID in PlantcircBase | osa_circ_031775 |
Alias | Os_ciR10526 |
Organism | Oryza sativa |
Position | chr6: 26487019-26487210 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os06g0648200 |
Parent gene annotation |
Conserved hypothetical protein. (Os06t0648200-01);Hypothetical p rotein. (Os06t0648200-02);Hypothetical conserved gene. (Os06t064 8200-03);Hypothetical conserved gene. (Os06t0648200-04);Hypothet ical conserved gene. (Os06t0648200-05) |
Parent gene strand | - |
Alternative splicing | Os06g0648200_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0648200-04:1 Os06t0648200-05:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016482 |
PMCS | 0.092447917 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26487173-26487108(+) 26487192-26487094(+) 26487103-26487209(-) |
Potential amino acid sequence |
MSPVSTDEWLTDHLRASEDSAEGSSGIPEQLLMGWRSPLAMYL*(+) MSGSLIICERARIQRKEAAGYQNSCSWGGDHR*(+) MASGDLHPMSSCSGIPLLPSAESSLARR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |