Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0648200_circ_g.1 |
| ID in PlantcircBase | osa_circ_031775 |
| Alias | Os_ciR10526 |
| Organism | Oryza sativa |
| Position | chr6: 26487019-26487210 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os06g0648200 |
| Parent gene annotation |
Conserved hypothetical protein. (Os06t0648200-01);Hypothetical p rotein. (Os06t0648200-02);Hypothetical conserved gene. (Os06t064 8200-03);Hypothetical conserved gene. (Os06t0648200-04);Hypothet ical conserved gene. (Os06t0648200-05) |
| Parent gene strand | - |
| Alternative splicing | Os06g0648200_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0648200-04:1 Os06t0648200-05:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016482 |
| PMCS | 0.092447917 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26487173-26487108(+) 26487192-26487094(+) 26487103-26487209(-) |
| Potential amino acid sequence |
MSPVSTDEWLTDHLRASEDSAEGSSGIPEQLLMGWRSPLAMYL*(+) MSGSLIICERARIQRKEAAGYQNSCSWGGDHR*(+) MASGDLHPMSSCSGIPLLPSAESSLARR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |