Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0456500_circ_g.5 |
| ID in PlantcircBase | osa_circ_006976 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 16691253-16691382 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os10g0456550 |
| Parent gene annotation |
Hypothetical protein. (Os10t0456550-00) |
| Parent gene strand | - |
| Alternative splicing | Os10g0456500_circ_g.4 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0456500-02:1 Os10t0456500-01:1 Os10t0456550-00:1 Os10t0456500-02:1 Os10t0456500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.099358526 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16691316-16691255(+) 16691280-16691294(-) |
| Potential amino acid sequence |
MVHHLCCKKYILLLKRRKLWLSSGEKELWVPFDNTPYCSTTAFDGASSVLQEVYTSLKAAEIVV EQW*(+) MGPTAPFHHCSTTISAALREVYTSCNTDDAPSNAVVEQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |