Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d028045_circ_g.2 |
| ID in PlantcircBase | zma_circ_006426 |
| Alias | Zm01circ00036, GRMZM2G064841_C1 |
| Organism | Zea mays |
| Position | chr1: 21515358-21515861 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d028045 |
| Parent gene annotation |
Mannose-1-phosphate guanylyltransferase 1 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d028045_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | NA:0 Zm00001d028045_T003:3 Zm00001d028045_T007:3 Zm00001d028045_T011:3 Zm00001d028045_T009:3 Zm00001d028045_T006:3 Zm00001d028045_T010:3 Zm00001d028045_T004:2 Zm00001d028045_T001:3 Zm00001d028045_T002:3 Zm00001d028045_T008:3 Zm00001d028045_T005:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.138779001 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21515382-21515858(+) |
| Potential amino acid sequence |
MGTLLVNKVSAESANQFGELVADPETNELLHYTEKPETFVSDLINCGVYIFTPNIFSAIEDVLK QKKDREAHKKYGGMGTLLVNKVSAESANQFGELVADPETNELLHYTEKPETFVSDLINCGVYIF TPNIFSAIEDVLKQKKDREAHKKYGGMGTLLVNKVSAESANQFGELVADPETNELLHYTEKPET FVSDLINCGVYIFTPNIFSAIEDVLKQKKDREAHKKYGGMGTLLVNKVSAESANQFGELVADPE TNELLHYTEKPETFVSDLINCGVYIFTPNIFSAIEDVLKQKKDR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |