Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0180400_circ_g.1 |
ID in PlantcircBase | osa_circ_018208 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 4211301-4211383 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os03g0180400 |
Parent gene annotation |
Proteasome subunit alpha type 6 (EC 3.4.25.1) (20S proteasome al pha subunit A) (20S proteasome subunit alpha-1). (Os03t0180400-0 1) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0180400-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.436646988 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4211367-4211364(-) 4211380-4211364(-) |
Potential amino acid sequence |
MTKRKTLNYSNVTRQVTSLDISCYGLGL*(-) MVLGYDEEKNAQLFKCDPAGHFFGHKLLWSWAMTKRKTLNYSNVTRQVTSLDISCYGLGL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |