Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0180400_circ_g.1 |
| ID in PlantcircBase | osa_circ_018208 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 4211301-4211383 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0180400 |
| Parent gene annotation |
Proteasome subunit alpha type 6 (EC 3.4.25.1) (20S proteasome al pha subunit A) (20S proteasome subunit alpha-1). (Os03t0180400-0 1) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0180400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.436646988 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4211367-4211364(-) 4211380-4211364(-) |
| Potential amino acid sequence |
MTKRKTLNYSNVTRQVTSLDISCYGLGL*(-) MVLGYDEEKNAQLFKCDPAGHFFGHKLLWSWAMTKRKTLNYSNVTRQVTSLDISCYGLGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |