Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0710800_circ_g.4 |
ID in PlantcircBase | osa_circ_021208 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 28665413-28666525 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0710800 |
Parent gene annotation |
14-3-3-like protein S94. (Os03t0710800-01) |
Parent gene strand | + |
Alternative splicing | Os03g0710800_circ_g.1 Os03g0710800_circ_g.2 Os03g0710800_circ_g.3 Os03g0710800_circ_g.5 Os03g0710800_circ_g.6 Os03g0710800_circ_g.7 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0710800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.466107435 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28665463-28665439(+) 28665482-28666479(-) |
Potential amino acid sequence |
MSPAEASREENVYMAKLAEQAERYEEMVEFMEKVAKTTDVGELTVEERNLLSVAYKNVIGARRA SWRIISSIEQKEESRGNEAYVASIKEYRSRIETELSKICDGILKLLDSHLVPSATAAESKVFYL KMKGDYHRYLAEFKSGAERKEAAENTLVAYKSAQDIALADLPTTHPIRLGLALNFSVFYYEILN SPDRACNLAKQVHKVRLSLR*(+) MPQQATFFLSFVLQRKLSLTLCTCFARLQARSGEFSIS*(-) |
Sponge-miRNAs | osa-miR167i-5p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |