Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G19880_circ_g.1 |
| ID in PlantcircBase | ath_circ_013861 |
| Alias | At_ciR3950 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 8582155-8582477 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT2G19880 |
| Parent gene annotation |
Nucleotide-diphospho-sugar transferases superfamily protein |
| Parent gene strand | + |
| Alternative splicing | AT2G19880_circ_g.2 AT2G19880_circ_g.3 AT2G19880_circ_g.4 AT2G19880_circ_g.5 AT2G19880_circ_g.6 AT2G19880_circ_g.7 AT2G19880_circ_g.8 AT2G19880_circ_g.9 AT2G19880_circ_g.10 AT2G19880_circ_g.11 AT2G19880_circ_g.12 AT2G19880_circ_g.13 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G19880.2:2 AT2G19880.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.199432479 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8582427-8582474(+) |
| Potential amino acid sequence |
MPLKGFGEHNLHNWRSQGCTICLLLALGWLLAEYVRNREVKRIKNSIKAGNSLAFLYQDINELE HSRQVKLPRVSVVMPLKGFGEHNLHNWRSQGCTICLLLALGWLLAEYVRNREVKRIKNSIKAGN SLAFLYQDINELEHSRQVKLPRVSVVMPLKGFGEHNLHNWRSQGCTICLLLALGWLLAEYVRNR EVKRIKNSIKAGNSLAFLYQDINELEHSRQVKLPRVSVVMPLKGFGEHNLHNWRSQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |