Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G28310_circ_g.1 |
ID in PlantcircBase | ath_circ_015341 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 12087030-12087143 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT2G28310 |
Parent gene annotation |
Putative uncharacterized protein At2g28310 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G28310.3:1 AT2G28310.1:1 AT2G28310.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.563105919 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12087109-12087140(+) |
Potential amino acid sequence |
MTKRRGDREVHKYIELVKKHGLEISQPGLEPNNGLTWEMTKRRGDREVHKYIELVKKHGLEISQ PGLEPNNGLTWEMTKRRGDREVHKYIELVKKHGLEISQPGLEPNNGLTWEMTKRRGDREVH(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |