Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d038894_circ_g.2 |
ID in PlantcircBase | zma_circ_009168 |
Alias | zma_circ_0002419, GRMZM2G010349_C1 |
Organism | Zea mays |
Position | chr6: 166587211-166587552 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d038894 |
Parent gene annotation |
Serine/threonine-protein kinase STN7 chloroplastic |
Parent gene strand | - |
Alternative splicing | Zm00001d038894_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d038894_T002:2 Zm00001d038894_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.341432113 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
166587486-166587232(+) 166587476-166587506(-) |
Potential amino acid sequence |
MILFSLAIPFGKSWIPPRIFVSTLDPKGTL*(+) MRQLLFALDGLHSTGIVHRDIKPQNVIFSEGSRTFKIIDLGAAADLRVGINYIPKEFLLDPRWR QKFLAVSKTCQRE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |