Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G19020_circ_g.1 |
| ID in PlantcircBase | ath_circ_031634 |
| Alias | At_ciR4831 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 10416983-10417289 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT4G19020 |
| Parent gene annotation |
DNA (cytosine-5)-methyltransferase CMT2 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G19020.1:2 AT4G19020.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.191640499 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10417173-10417286(+) |
| Potential amino acid sequence |
MERQATNHDKRRLFYSTVMNDNPVDCLISKVTVLQVSPRGEEEETHVGQIVEFFKTTDGESYFR VQWFYRATDTIMERQATNHDKRRLFYSTVMNDNPVDCLISKVTVLQVSPRGEEEETHVGQIVEF FKTTDGESYFRVQWFYRATDTIMERQATNHDKRRLFYSTVMNDNPVDCLISKVTVLQVSPRGEE EETHVGQIVEFFKTTDGESYFRVQWFYRATDTIMERQATNHDKRRLFYSTVMNDNPVDCLISKV TVLQVSPR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |