Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0673100_circ_g.3 |
ID in PlantcircBase | osa_circ_035262 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 28449940-28450369 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0673100 |
Parent gene annotation |
Ribosomal protein S8e domain containing protein. (Os07t0673100-0 1) |
Parent gene strand | - |
Alternative splicing | Os07g0673100_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0673100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.233938953 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28450300-28449958(+) 28450364-28450367(-) 28450330-28450330(-) |
Potential amino acid sequence |
MEEEHPLEHHQPSAEKLTRRAFSGFSLASS*(+) MHDESTSRQKVDDVQEGALPPYLLDRDQTQRAKVLSNTIKQKRMEKAGKWEVPLPKVRPVAEEE MFKVLRTGKRKT*(-) MMFKRVLFLHICWTVIRHNVPRFSATQLSKRGWKRLANGRFLCQRSDLWLKKKCSKFYELAREK PENARRVNFSAEG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |